Sign In | Join Free | My uabig.com
uabig.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    tin reactions

    All tin reactions wholesalers & tin reactions manufacturers come from members. We doesn't provide tin reactions products or service, please contact them directly and verify their companies info carefully.

    Total 1915 products from tin reactions Manufactures & Suppliers
    Wholesale  from china suppliers

    Place of Origin:Dongguan,Guangdong,China

    Brand Name:YOU ZE

    Model Number:BG-008

    ... days after samples confirmed and deposit received. Description: Christmas Cookie Tin Our products Packaing tin box:coffee box,tea box,biscuit tin,mint tin,candy box,chocolate box,wine bottle box,watch box,cosmetic...

    Dongguan You Ze Metal Product Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:HUIMEI

    Model Number:HM-dabco 120

    Place of Origin:China

    ...(dodecylthio)tin / CAS 1185-81-5 / dabco 120 / t-120 / DI-N-BUTYLBIS(DODECYLTHIO)TIN Product Description DI-N-BUTYLBIS(DODECYLTHIO)TIN Basic information Product Name: DI-N-BUTYLBIS(DODECYLTHIO)TIN Synonyms: DI-N-BUTYLBIS(DODECYLTHIO)TIN;DIBUTYL TIN BIS...

    Changzhou Huimei Chemical Co., Ltd.
    Verified Supplier

    Jiangsu

    Wholesale  from china suppliers

    Brand Name:WAXKISS

    Model Number:T8E

    Place of Origin:GUANGZHOU, CHINA

    ... Description Product Name: Soft Hair Removal Wax Materials: colophonium, mineral oil, Microcrystalline wax Packing: 800gram/tin can, 12cans/carton Usage: Body and face hair removal Ideal for coarse hairs Up to...

    Guangzhou Fourto Sanitary Products Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:VAKIA

    Model Number:CAC

    Place of Origin:China

    ...crochet hook / bearded needle vacuum plating system / TiN coating equipment General Information working principle The multi-arc ion plating machine is application vacuum ...

    SHANGHAI VAKIA COATING TECHNOLOGY CO.,LTD.
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Place of Origin:China

    Brand Name:Ycphar

    ...-61-5 Molecular Formula: C25H34O3 Molecular weight: 382.54 Standard: Enterprise Standard Packing: foil bag or tin. Delivery: Express courier. Appearance: pale yellow or yellow crystalline powder; MP: 72~78°C Usage: pharmaceutical...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:SCL

    Model Number:EL-04

    Place of Origin:SHANGHAI,CHINA

    Custom Electronic Machining CNC Turning Stainless Steel Electronic spare parts Basic Information: CNC Machining or Not: CNC Machining Place of Origin: Shanghai, China (Mainland) Model Number: EL-04 Brand Name: SCL Keywords: cnc machining Sample time: 5-7 ...

    SHANGHAI CHELI INTERNATIONAL TRADE CO.,LTD
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Brand Name:Guangzhou Huao

    Model Number:104632-26-0

    Place of Origin:Guangzhou China

    Pharmaceutical Raw Materials Pramipexole for Treat Parkinson's Disease Quick info: Chemical name: Pramipexole Appearance: White powder MF: C10H21Cl2N3OS MW: 302.26 CAS: 191217-81-9 MOQ: 10g Pramipexole explanation 1. Pramipexole can be a dopamine agonist ...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Bodybuilding

    Model Number:863288-34-0

    Place of Origin:China

    CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale  from china suppliers

    Brand Name:www.steroidaily.com

    Model Number:58-33-3

    Place of Origin:China

    Promethazine Hydrochloride Pharmaceutical Raw Material 58-33-3 Treat Allergic Disorders 1. Key Information of Promethazine hydrochloride Product name: Promethazine hydrochloride Other Name 10-(2-dimethylamino-1-propyl)phenothiazine hydrochloride;...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Medipharm/Shinepharm

    Model Number:AMC12022

    Place of Origin:CHINA

    Indications: Metronidazole is the drug of choice for symtopmatic intestinal and extraintestinal amebiasis as well as infections with Trichomonas vaginalis and Giardia lamblia. It is quickly and reliably effective against Gardnerella vaginosis. Contra-...

    Anhui Medipharm Co.,Ltd.
    Active Member

    Anhui

    Wholesale  from china suppliers

    Place of Origin:China

    It is a low viscosity polyurethane additives which is dissolved in common organic solvents. It has a special catalytic effect,can promote the reaction of one-step polyurethane hydroxyl isocyanate,a high activity gel reaction catalyst

    shijiazhuang pinge chem.ltd
    Site Member

    Hebei

    Wholesale  from china suppliers

    Brand Name:rato

    Model Number:262

    Place of Origin:China

    ...custom tin custom full color laser engraved buttons with logo printing: 1. material Aluminum, PVC acrylic ,metal,zinc ...

    RATO PRINTING LTD
    Site Member

    Guangdong

    Wholesale  from china suppliers

    Brand Name:GreatSilicone

    Model Number:GS-C30/35/40

    Place of Origin:China

    ... silicone rubber for culture stone casting 1.Description of Rtv-2 molding tin cure silicone rubber for culture stone casting RTV2 Tin cure Silicone rubber is condensation cure silicone rubber for mold making.It...

    Hongkong Great silicone technology co.,limited
    Active Member

    Wholesale  from china suppliers

    Place of Origin:China

    Brand Name:Nuoda

    Model Number:Nuoda1280

    ... agent (in acid solution), and in electrolytic baths for tin-plating. Tin(II) chloride should not be confused with the other chloride of tin; tin(IV) chloride or stannic chloride (SnCl4). The Specification of...

    Tianjin Nuoda International Trade Co.,Ltd.
    Active Member

    Tianjin

    Wholesale  from china suppliers

    Brand Name:Lambut

    Model Number:10-100nm

    Place of Origin:China

    ... (Si3N4) Nano boron nitride powder (BN) Nano Zirconium nitride powder (ZrN) Nano Titanium nitride powder (TiN) Nano Chromium nitrite powder (CrN) Nano Aluminum nitrite powder (AlN) Packing: With inert gas anti...

    LAMBUT HEAVY STEEL FORGING
    Active Member

    Jiangsu

    Wholesale  from china suppliers

    Place of Origin:Chongqing

    Brand Name:YQ

    Model Number:4*1

    ... M5 8, high accuracy, stable, long life span ; 9.high quality service; 10.resonable price; 11,coating:TIN or TIAIN Type Ι(Straight Teeth ) mm. Key Size Outside Diameter Width of tooth Length Neck...

    Chongqing Duoduo Power Machine Limited Company
    Active Member

    Chongqing

    Wholesale  from china suppliers

    Place of Origin:chongqing

    Brand Name:YQ

    CYLINDRICAL CUTTER specification of products Coarse Teeth mm Dialeter Length Hole Dia Number of Teeth 63 50 27 6 63 63 27 6 63 80 27 6 63 100 27 6 80 63 32 8 80 80 32 8 80 100 32 8 80 125 32 8 100 80 40 10 100 100 40 10 100 125 40 10 100 160 40 10 Fine ...

    Chongqing yuqing machine tools co,ltd
    Active Member

    Chongqing

    Wholesale  from china suppliers

    Model Number:99.5% Min

    Place of Origin:China

    ...Cas No. 12125-02-9 99.5% Ammonium Chloride Reaction Industrial Chemicals NH4Cl White Powder Specifications: Item National Standard Analysis Result Nh4CL content (on dry ...

    Wuhan Kangzheng Science And Technology Co., Ltd.
    Active Member

    Hubei

    Wholesale  from china suppliers

    Place of Origin:china

    Heavy-duty vertical shaft impact crusher has absorbed many advantages of similar products at home and abroad on the basis of the main technical parameters to optimize the design developed from the new crushing, coarse grinding products for iron ore, sand,...

    Nado (beijing) Global Investment Ltd.
    Active Member

    Beijing

    Wholesale  from china suppliers

    Brand Name:JIANHUI

    Place of Origin:China (mainland)

    Model Number:Electrolytic tin plate-1-1-1-1

    ... on surface Not easy to rust Produced by iron plate dipping into melted tin liquid Tin less active than ferrum, neither oxidized by air nor reacting with water Very strong anti-...

    Henan Jianhui Construction Machinery Co. Ltd
    Active Member

    Henan

    Inquiry Cart 0